FRalanyzer Results of Query 1ylo with Template 1cg2A


1cg2A: carboxypeptidase g2



                     10        20           30        40              50        60        70        80        90       100       110       120       130       140       150       160        170       180         190       200       210         220       230       240       250                                                                                                                         260       270       280       290       300        310        320       330       340        
Query Swissprot Domains
                        *********   **********************                                                                                                                                                                                                                                                                                                                                                                                                                                                 
Predicted Secondary Structure
                                                                                                                                               
Query Sequence of 1ylo   
             SNAXDLSLLKALSEADAIAS   SEQEVRQILLEEAARLQKEVRFDGL      GSVLIRLNESTGPKVXICAHXDEVGFXVRSISREGAIDVLPVGNVRXAARQLQPVRITTREECKIPGLLDGDRQGNDVSAXRVDIGARTYDEVXQAGIRPGDRVTFDTTFQVLPHQRVXGKAF DDRLSCYLLVTLLRELH  DAELPAEVWLVASSSEEVGLRGGQTATRAV  SPDVAIVLDTACWAKNFDYGAANHRQIGNGPXLVLSDK                                                                                                               SLIA   PPKLTAWIETVAAEIGVPLQADXFSNGGTDGGAVHLTGTGVPTLVX GPATRHGHCAASIA DCRDILQXEQLLSALIQRLTRETVVQLTDFR
1cg2 A Sequence from alignment   
QKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYL                                                                            KGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPT               SAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALS  GKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAGK        
Secondary Structure
----HHHHHHHHHHHHHHHHHHHHHHt----t-tHHHHHHHHHHHHHHHHH---EEEEEE--t----EEEEEEEE------EEEEEE------                                                                            t-HHHH---EEEt-EEE-t-----HHHHHHHHHHHHHHHH----t--EEEEEEEt-HHH--tt-HHHHHHHHHH-tEEEE---E               Ett--EEE-EE-EEEEEEEEEE---EEtt--HHH---HHHHHHHHHHHHHHH--tt--EEEEEEEEEE---t-EE--EEEEEEEEEE--HHHHHHHHHHHHHHH-t-t-t--EEEEEEEE----EE-HHHHHHHHHHHHHHHHH-----EEE--------HHHHHHH  ---EE-----EEE-t------EEEHHHHHHHHHHHHHHHHHHH--         
(PDB numbering for template)
         35        45        55        65        75        85        95        105       115                                                                                   125       135       145       155       165       175       185       195                      205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365         375       385       395       405               
Residue Conservation
-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Active site residues
                                                                                      *                                                                                                        *                                  *                       *                                                                                                                                                                                                         *                                      
Template Swissprot ASR
                                                                                                                                                                                                                            -  ----                                                                                                                                                                                                                                                                        
Prosite Pattern
                                                                                 LLLMSH D V                                                                                                  IAD KG  A  L    -  ----- -  I VLF  DEE-G                                                                                    -  - -- -- -                                                                                                                                                                      
[LIV]-[GALMY]-[LIVMF]-{Q}-[GSA]-H-x-D-[TV]-[STAV]
[GSTAI]-[SANQCVIT]-D-x-K-[GSACN]-x(1,2)-[LIVMA]-x(2)-[LIVMFY]-x(12,17)-[LIVM]-x-[LIVMF]-[LIVMSTAGC]-[LIVMFA]-x(2)-[DNGM]-E-E-x(0,1)-[GSTNE]
Contacts to Ligand
    --  -                                                                             -                                                                                                        -                 -               --  -              ---                     --     --     -                             - ---          --  - -   -  -   --     -    -          -                                                                                  -                                        
Contacts to Metal
                                                                                      -                                                                                                        -                                  -                                         -                                                                            -                                                                                                                                                 
Template Swissprot Metals
                                                     -  --    -  --             -   --*                                                                                                       -*                                - *      -           -----*                  -   -             -                                                                             -                                                                       -     -   -----*                                      
Template Swissprot Signals
------------                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               
H bonds to Ligand
                                                                                      -                                                                                                        -                                 --                   -                     --     -                                      ---                            -                     -                                                                                  -                                        


Sequence Identity Match: 50/247=20%,

Secondary Structure Match: 0/247=0%

Information of Template Sequence from PDBSum and SwissProt Databases

PDBSum Info To BringLocal Copy
Residue Conservation
Active Side Residue
Prosite
Contacts to DNA (no information)
Contacts to Ligand(s)
Contacts to Metal(s)
Hbonds to ligand(s)
Select All


SwissProt Info
SwissProt Information for Template (local copy available)


Best Hit : CBPG_PSES6 Carboxypeptidase G2 precursor (EC 3.4.17.11) (Folate hydrolase G2) (Pteroylmonoglutamic acid hydrolase G2) (Glutamate carboxypeptidase).
seq. id. 100 %, evalue 0.0
See blast file

Template Swissprot Active Side Residue
Template Swissprot Prosite (no information)
Template Swissprot Disulfid (no information)
Template Swissprot DNA (no information)
Template Swissprot Metal
Template Swissprot Binding (no information)
Template Swissprot Cabind (no information)
Template Swissprot Signal
Template Swissprot Domain (no information)


Information of Query Sequence from SwissProt Database


SwissProt Info
SwissProt Information for Query (local copy available)


Best Hit : YPDE_ECOLI Hypothetical protein ypdE.
seq. id. 95 %, evalue 0.0
See blast file
Query Swissprot Active Side Residue (no information)
Query Swissprot Prosite (no information)
Query Swissprot Disulfid (no information)
Query Swissprot DNA (no information)
Query Swissprot Metal (no information)
Query Swissprot Binding (no information)
Query Swissprot Cabind (no information)
Query Swissprot Signal (no information)
Query Swissprot Domain

Retreive secondary structure and full sequence

Secondary Structure
Sequence from PDB



COG search

Run Cognitor for Query Sequence



Domain Prediction

Run Domain Prediction for Query using Meta-DP


GO Prediction

Run GO Prediction for Query at Meta-GO



Representation of conserved regions from Low to High: 1 2 3 4 5 6 7 8 9



Previous Page

Main Page